PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G2703
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 338aa    MW: 37886.5 Da    PI: 7.0111
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G2703genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.4e-191663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+d+++++G g+W++ ++  g++R++k+c++rw +yl
      Gh_A11G2703 16 KGPWTPEEDRILIDYIQKHGHGSWRALPNLAGLNRCGKSCRLRWTNYL 63
                     79********************************************97 PP

2Myb_DNA-binding54.92e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE++ ++++++ lG++ W++Ia +++ gRt++++k++w++++
      Gh_A11G2703  69 RGKFSDEEEQTIINLHAVLGNK-WSAIATHLP-GRTDNEIKNFWNTHM 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.3821163IPR017930Myb domain
SuperFamilySSF466891.62E-3113110IPR009057Homeodomain-like
SMARTSM007171.3E-151565IPR001005SANT/Myb domain
PfamPF002492.1E-171663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-251770IPR009057Homeodomain-like
CDDcd001672.00E-121863No hitNo description
PROSITE profilePS5129426.9164118IPR017930Myb domain
SMARTSM007175.3E-1668116IPR001005SANT/Myb domain
PfamPF002495.6E-1669113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2771118IPR009057Homeodomain-like
CDDcd001675.18E-1271114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MMARPPSGND ENGVKKGPWT PEEDRILIDY IQKHGHGSWR ALPNLAGLNR CGKSCRLRWT  60
NYLRPDIKRG KFSDEEEQTI INLHAVLGNK WSAIATHLPG RTDNEIKNFW NTHMRKKLLQ  120
MGIDPVTHRP RTDHLNILAS LPQLLAAANF NNMNNLFDVN AINRLQLDAA TLAKLHLLHN  180
MLQILGTPAI NAMDFLSGPT FRDHQLSHLQ PNTGDYQPSN LIEASQNTHP LKDLKFSSYI  240
NNDRFASSYS SSSSSLFVAN NNIPSSSIPQ LPALIPASPE HRPAVVENNK INNPNEISNP  300
SSTSTTFEAW GDLMDDEASD SYWRDIIDQA SSQSWPIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-28161184105MYB PROTO-ONCOGENE PROTEIN
1h8a_C6e-281611827128MYB TRANSFORMING PROTEIN
1mse_C4e-28161184105C-Myb DNA-Binding Domain
1msf_C4e-28161184105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012434825.10.0PREDICTED: transcription factor MYB39-like isoform X1
TrEMBLA0A0D2TRP40.0A0A0D2TRP4_G
STRINGVIT_16s0039g01710.t011e-138(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-103myb domain protein 9